3D model is for representation purpose only.
.
.
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY | Maleimide derivative of doxorubicin |
Identification | |
---|---|
ConjuPepDB ID | cpd00018 | Peptide information |
Sequence (one letter) | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Length | 36 |
Peptide name | Neuropeptide Y (NPY) |
Other information | |
---|---|
Application | Tumor-Specific Chemotherapy |
Linker | N/A |
Small molecule | Maleimide derivative of doxorubicin |
Small molecule CAS | 82069-05-04 |
Citations | |||||
---|---|---|---|---|---|
ID | Title | Year | Authors | Journal | DOI |
Novel peptide conjugates for tumor-specific chemotherapy. | 2001 | Langer, Michael; Kratz, Felix; Rothen-Rutishauser, Barbara; Wunderli-Allenspach, Heidi; Beck-Sickinger, Annette G. | Journal of Medicinal Chemistry |