Use the buttons at the bottom of Jsmol viewer to see different representations, ON/OFF Hydrogens, and ON/OFF rotation.
3D model is for representation purpose only.
.
.
Schematic representation of peptide, linker and drug in the peptide-drug conjugates
 |
 |
 |
|
 |
|---|---|---|---|---|
| YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY | Maleimide derivative of daunorubicin |
| Identification | |
|---|---|
| ConjuPepDB ID | cpd00017 | Peptide information |
| Sequence (one letter) | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Length | 36 |
| Peptide name | Neuropeptide Y (NPY) |
| Other information | |
|---|---|
| Application | Tumor-Specific Chemotherapy |
| Linker | N/A |
| Small molecule | Maleimide derivative of daunorubicin |
| Small molecule CAS | 188530-64-5 |
| Small molecule structure | |
| Citations | |||||
|---|---|---|---|---|---|
| ID | Title | Year | Authors | Journal | DOI |
Novel peptide conjugates for tumor-specific chemotherapy. | 2001 | Langer, Michael; Kratz, Felix; Rothen-Rutishauser, Barbara; Wunderli-Allenspach, Heidi; Beck-Sickinger, Annette G. | Journal of Medicinal Chemistry | ||
